Placeholder image of a protein
Icon representing a puzzle

2693: Electron Density Reconstruction 146

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
November 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

Sequence
MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups


  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 28,619
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,146

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 39,138
  2. Avatar for Aarav_Awasthi 2. Aarav_Awasthi Lv 1 93 pts. 38,878
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 87 pts. 38,691
  4. Avatar for LociOiling 4. LociOiling Lv 1 81 pts. 38,436
  5. Avatar for Galaxie 5. Galaxie Lv 1 75 pts. 38,374
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 69 pts. 38,146
  7. Avatar for spvincent 7. spvincent Lv 1 64 pts. 38,085
  8. Avatar for akaaka 8. akaaka Lv 1 59 pts. 38,053
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 55 pts. 37,741
  10. Avatar for Zhang Ruichong 10. Zhang Ruichong Lv 1 50 pts. 37,693

Comments


LociOiling Lv 1

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….