2693: Electron Density Reconstruction 146
Closed since 4 months ago
Novice Overall Prediction Electron DensitySummary
- Created
- November 18, 2025
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.
- Sequence
- MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE
Top groups
-
1. VeFold100 pts. 39,138 -
-
-
-
-
-
-
-
-
-
1. ZeroLeak7 Lv 1100 pts. 39,138 -
-
-
-
-
-
-
-
-
Comments
LociOiling Lv 1
I meant to add this is "DNA repair and recombination protein radB", as identified in the FASTA file.