Placeholder image of a protein
Icon representing a puzzle

2693: Electron Density Reconstruction 146

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary


Created
November 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

Sequence
MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups


  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 28,619
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,146

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 19 pts. 37,025
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 17 pts. 36,824
  3. Avatar for majyunyan 23. majyunyan Lv 1 15 pts. 36,779
  4. Avatar for AlkiP0Ps 24. AlkiP0Ps Lv 1 14 pts. 36,766
  5. Avatar for westchuck 25. westchuck Lv 1 12 pts. 36,573
  6. Avatar for meatexplosion 26. meatexplosion Lv 1 11 pts. 36,481
  7. Avatar for g_b 27. g_b Lv 1 10 pts. 36,320
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 9 pts. 36,254
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 8 pts. 35,674
  10. Avatar for bravosk8erboy 30. bravosk8erboy Lv 1 7 pts. 35,614

Comments


LociOiling Lv 1

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….