Placeholder image of a protein
Icon representing a puzzle

2693: Electron Density Reconstruction 146

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
November 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

Sequence
MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups


  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 28,619
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,146

  1. Avatar for Xendrais 41. Xendrais Lv 1 2 pts. 33,155
  2. Avatar for hada 42. hada Lv 1 2 pts. 33,012
  3. Avatar for jausmh 43. jausmh Lv 1 1 pt. 32,928
  4. Avatar for Moolanie 44. Moolanie Lv 1 1 pt. 32,390
  5. Avatar for onietsabari 45. onietsabari Lv 1 1 pt. 32,184
  6. Avatar for rosie4loop 46. rosie4loop Lv 1 1 pt. 32,060
  7. Avatar for aendgraend 47. aendgraend Lv 1 1 pt. 31,255
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 1 pt. 31,170
  9. Avatar for carxo 49. carxo Lv 1 1 pt. 30,902
  10. Avatar for pfirth 50. pfirth Lv 1 1 pt. 30,508

Comments


LociOiling Lv 1

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….