Placeholder image of a protein
Icon representing a puzzle

2693: Electron Density Reconstruction 146

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary

Created
November 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

Sequence
MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups

  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 28,619
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,146
  1. Avatar for zbp 51. zbp Lv 1 1 pt. 29,534
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 29,503
  3. Avatar for ZiiONIC 53. ZiiONIC Lv 1 1 pt. 29,242
  4. Avatar for rovergaard 54. rovergaard Lv 1 1 pt. 28,619
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 28,377
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 28,242
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 28,136
  8. Avatar for Wildice1100 58. Wildice1100 Lv 1 1 pt. 27,673
  9. Avatar for drumpeter18yrs9yrs 59. drumpeter18yrs9yrs Lv 1 1 pt. 27,634
  10. Avatar for RWoodcock 60. RWoodcock Lv 1 1 pt. 27,502

Comments

LociOiling Lv 1

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….