2693: Electron Density Reconstruction 146

Closed since 3 months ago

Summary

• Created: November 18, 2025
• Expires: December 04, 2025 at 17:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

• Sequence: MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups

• 1. VeFold 100 pts. 39,138
• 2. Contenders 63 pts. 39,095
• 3. Go Science 37 pts. 38,878
• 4. Anthropic Dreams 21 pts. 38,448
• 5. L'Alliance Francophone 11 pts. 38,146
• 6. FamilyBarmettler 5 pts. 37,025
• 7. Australia 2 pts. 36,766
• 8. Void Crushers 1 pt. 35,205
• 9. Marvin's bunch 1 pt. 32,928
• 10. SETI.Germany 1 pt. 31,255

Top evolvers

• 1. Bletchley Park 100 pts. 39,095
• 2. Bruno Kestemont 41 pts. 38,696
• 3. toshiue 14 pts. 38,696
• 4. bravosk8erboy 4 pts. 38,692
• 5. silent gene 1 pt. 38,688
• 6. Galaxie 1 pt. 38,448
• 7. LociOiling 1 pt. 38,431

Comments

[LociOiling]

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….

[LociOiling]

I meant to add this is "DNA repair and recombination protein radB", as identified in the FASTA file.