Placeholder image of a protein
Icon representing a puzzle

2693: Electron Density Reconstruction 146

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
November 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

Sequence
MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups


  1. Avatar for VeFold
    1. VeFold
    100 pts. 39,138
  2. Avatar for Contenders 2. Contenders 63 pts. 39,095
  3. Avatar for Go Science 3. Go Science 37 pts. 38,878
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 38,448
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 38,146
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 37,025
  7. Avatar for Australia 7. Australia 2 pts. 36,766
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 35,205
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 32,928
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 31,255

  1. Avatar for p.naka 61. p.naka Lv 1 1 pt. 27,473
  2. Avatar for malia 62. malia Lv 1 1 pt. 27,394
  3. Avatar for prkfour 63. prkfour Lv 1 1 pt. 27,250
  4. Avatar for jdmclure 64. jdmclure Lv 1 1 pt. 27,046
  5. Avatar for efull 65. efull Lv 1 1 pt. 26,446
  6. Avatar for zhengyichen 66. zhengyichen Lv 1 1 pt. 23,490
  7. Avatar for benchagot 67. benchagot Lv 1 1 pt. 23,261
  8. Avatar for jamiexq 68. jamiexq Lv 1 1 pt. 22,683
  9. Avatar for Joanna_H 69. Joanna_H Lv 1 1 pt. 13,146
  10. Avatar for apetrides 70. apetrides Lv 1 1 pt. 0

Comments


LociOiling Lv 1

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….