Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 6 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for BearCorp 11. BearCorp 1 pt. 10,697
  2. Avatar for Crosby Bio 222 F20 12. Crosby Bio 222 F20 1 pt. 10,552
  3. Avatar for Dr. House's team 13. Dr. House's team 1 pt. 10,457

  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 52 pts. 12,500
  2. Avatar for grogar7 12. grogar7 Lv 1 49 pts. 12,473
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 45 pts. 12,470
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 42 pts. 12,468
  5. Avatar for TheGUmmer 15. TheGUmmer Lv 1 39 pts. 12,466
  6. Avatar for westchuck 16. westchuck Lv 1 36 pts. 12,409
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 34 pts. 12,332
  8. Avatar for Dr. Goochie 18. Dr. Goochie Lv 1 31 pts. 12,327
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 29 pts. 12,320
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 27 pts. 12,294

Comments