Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,846
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 12,790
  3. Avatar for VeFold 3. VeFold 41 pts. 12,633
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 12,470
  5. Avatar for Australia 5. Australia 14 pts. 12,468
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,466
  7. Avatar for Contenders 7. Contenders 4 pts. 12,332
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 12,294
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 11,781
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 11,056
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 52 pts. 12,500
  2. Avatar for grogar7 12. grogar7 Lv 1 49 pts. 12,473
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 45 pts. 12,470
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 42 pts. 12,468
  5. Avatar for TheGUmmer 15. TheGUmmer Lv 1 39 pts. 12,466
  6. Avatar for westchuck 16. westchuck Lv 1 36 pts. 12,409
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 34 pts. 12,332
  8. Avatar for Dr. Goochie 18. Dr. Goochie Lv 1 31 pts. 12,327
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 29 pts. 12,320
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 27 pts. 12,294

Comments