Icon representing a puzzle

2689: Revisiting Puzzle 60: Beta Barrel

Closed since 5 months ago

Novice Overall Prediction

Summary


Created
November 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Go Science 100 pts. 12,846
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 12,790
  3. Avatar for VeFold 3. VeFold 41 pts. 12,633
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 12,470
  5. Avatar for Australia 5. Australia 14 pts. 12,468
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,466
  7. Avatar for Contenders 7. Contenders 4 pts. 12,332
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 12,294
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 11,781
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 11,056

  1. Avatar for rosie4loop 51. rosie4loop Lv 1 1 pt. 11,657
  2. Avatar for ZiiONIC 52. ZiiONIC Lv 1 1 pt. 11,651
  3. Avatar for pfirth 53. pfirth Lv 1 1 pt. 11,630
  4. Avatar for Larini 54. Larini Lv 1 1 pt. 11,626
  5. Avatar for Hellcat6 55. Hellcat6 Lv 1 1 pt. 11,571
  6. Avatar for Alistair69 56. Alistair69 Lv 1 1 pt. 11,560
  7. Avatar for zbp 57. zbp Lv 1 1 pt. 11,485
  8. Avatar for hada 58. hada Lv 1 1 pt. 11,479
  9. Avatar for Merf 59. Merf Lv 1 1 pt. 11,387
  10. Avatar for ProfVince 60. ProfVince Lv 1 1 pt. 11,348

Comments