Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,839
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 22,810
  3. Avatar for Antharis Therapeutics 13. Antharis Therapeutics 1 pt. 22,743
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 22,652
  1. Avatar for akaaka 11. akaaka Lv 1 49 pts. 24,567
  2. Avatar for meatexplosion 12. meatexplosion Lv 1 45 pts. 24,566
  3. Avatar for nicobul 13. nicobul Lv 1 42 pts. 24,553
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 39 pts. 24,548
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 36 pts. 24,542
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 33 pts. 24,536
  7. Avatar for Xendrais 17. Xendrais Lv 1 30 pts. 24,527
  8. Avatar for ZeroLeak7 18. ZeroLeak7 Lv 1 28 pts. 24,520
  9. Avatar for jausmh 19. jausmh Lv 1 25 pts. 24,520
  10. Avatar for Zhang Ruichong 20. Zhang Ruichong Lv 1 23 pts. 24,513

Comments