Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 24,708
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 24,687
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 24,683
  4. Avatar for Contenders 4. Contenders 27 pts. 24,548
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 24,542
  6. Avatar for Australia 6. Australia 9 pts. 24,536
  7. Avatar for VeFold 7. VeFold 5 pts. 24,527
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 24,520
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 24,429
  10. Avatar for Team China 10. Team China 1 pt. 24,135
  1. Avatar for akaaka 11. akaaka Lv 1 49 pts. 24,567
  2. Avatar for meatexplosion 12. meatexplosion Lv 1 45 pts. 24,566
  3. Avatar for nicobul 13. nicobul Lv 1 42 pts. 24,553
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 39 pts. 24,548
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 36 pts. 24,542
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 33 pts. 24,536
  7. Avatar for Xendrais 17. Xendrais Lv 1 30 pts. 24,527
  8. Avatar for ZeroLeak7 18. ZeroLeak7 Lv 1 28 pts. 24,520
  9. Avatar for jausmh 19. jausmh Lv 1 25 pts. 24,520
  10. Avatar for Zhang Ruichong 20. Zhang Ruichong Lv 1 23 pts. 24,513

Comments