Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 22,839
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 22,810
  3. Avatar for Antharis Therapeutics 13. Antharis Therapeutics 1 pt. 22,743
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 22,652
  1. Avatar for NinjaGreg 31. NinjaGreg Lv 1 8 pts. 24,392
  2. Avatar for majyunyan 32. majyunyan Lv 1 7 pts. 24,336
  3. Avatar for manu8170 33. manu8170 Lv 1 6 pts. 24,329
  4. Avatar for alcor29 34. alcor29 Lv 1 6 pts. 24,259
  5. Avatar for Anfinsen_slept_here 35. Anfinsen_slept_here Lv 1 5 pts. 24,242
  6. Avatar for Dr.Sillem 36. Dr.Sillem Lv 1 5 pts. 24,240
  7. Avatar for zxspectrum 37. zxspectrum Lv 1 4 pts. 24,221
  8. Avatar for carsonfb 38. carsonfb Lv 1 4 pts. 24,154
  9. Avatar for LadyCrazy 39. LadyCrazy Lv 1 3 pts. 24,135
  10. Avatar for Idiotboy 40. Idiotboy Lv 1 3 pts. 24,035

Comments