Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 24,708
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 24,687
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 24,683
  4. Avatar for Contenders 4. Contenders 27 pts. 24,548
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 24,542
  6. Avatar for Australia 6. Australia 9 pts. 24,536
  7. Avatar for VeFold 7. VeFold 5 pts. 24,527
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 24,520
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 24,429
  10. Avatar for Team China 10. Team China 1 pt. 24,135
  1. Avatar for NinjaGreg 31. NinjaGreg Lv 1 8 pts. 24,392
  2. Avatar for majyunyan 32. majyunyan Lv 1 7 pts. 24,336
  3. Avatar for manu8170 33. manu8170 Lv 1 6 pts. 24,329
  4. Avatar for alcor29 34. alcor29 Lv 1 6 pts. 24,259
  5. Avatar for Anfinsen_slept_here 35. Anfinsen_slept_here Lv 1 5 pts. 24,242
  6. Avatar for Dr.Sillem 36. Dr.Sillem Lv 1 5 pts. 24,240
  7. Avatar for zxspectrum 37. zxspectrum Lv 1 4 pts. 24,221
  8. Avatar for carsonfb 38. carsonfb Lv 1 4 pts. 24,154
  9. Avatar for LadyCrazy 39. LadyCrazy Lv 1 3 pts. 24,135
  10. Avatar for Idiotboy 40. Idiotboy Lv 1 3 pts. 24,035

Comments