Placeholder image of a protein
Icon representing a puzzle

2696: Electron Density Reconstruction 147

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has both protein and DNA components, and comes from PDB entry 2DPU.

Sequence
MKEEKRSSTGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF CTATGAACATT ATGTTCATAG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 24,708
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 24,687
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 24,683
  4. Avatar for Contenders 4. Contenders 27 pts. 24,548
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 24,542
  6. Avatar for Australia 6. Australia 9 pts. 24,536
  7. Avatar for VeFold 7. VeFold 5 pts. 24,527
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 24,520
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 24,429
  10. Avatar for Team China 10. Team China 1 pt. 24,135
  1. Avatar for Matrena 61. Matrena Lv 1 1 pt. 22,771
  2. Avatar for <someone> 62. <someone> Lv 1 1 pt. 22,765
  3. Avatar for ycao 63. ycao Lv 1 1 pt. 22,755
  4. Avatar for RWoodcock 64. RWoodcock Lv 1 1 pt. 22,749
  5. Avatar for Bubbsalot 65. Bubbsalot Lv 1 1 pt. 22,743
  6. Avatar for yushiuan9499 66. yushiuan9499 Lv 1 1 pt. 22,652
  7. Avatar for efull 67. efull Lv 1 1 pt. 22,521
  8. Avatar for salbei 68. salbei Lv 1 1 pt. 22,206
  9. Avatar for apetrides 69. apetrides Lv 1 1 pt. 21,998
  10. Avatar for K00dlaty 70. K00dlaty Lv 1 1 pt. 10,110

Comments