Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 4 months ago

Novice Overall Prediction

Summary


Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,132
  2. Avatar for Team China 12. Team China 1 pt. 8,639
  3. Avatar for BPS_2025 13. BPS_2025 1 pt. 6,616
  4. Avatar for Ubuntu 14. Ubuntu 1 pt. 6,119

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,335
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 11,310
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 88 pts. 11,278
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 82 pts. 11,272
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 77 pts. 11,262
  6. Avatar for grogar7 6. grogar7 Lv 1 71 pts. 11,242
  7. Avatar for Aarav_Awasthi 7. Aarav_Awasthi Lv 1 66 pts. 11,236
  8. Avatar for nicobul 8. nicobul Lv 1 62 pts. 11,227
  9. Avatar for SemperRabbit 9. SemperRabbit Lv 1 57 pts. 11,226
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 53 pts. 11,218

Comments