Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 4 months ago

Novice Overall Prediction

Summary


Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Go Science 100 pts. 11,335
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,310
  3. Avatar for VeFold 3. VeFold 44 pts. 11,278
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,227
  5. Avatar for Australia 5. Australia 16 pts. 11,127
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,005
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,966
  8. Avatar for Contenders 8. Contenders 3 pts. 10,927
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,806
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,728

  1. Avatar for Dr. Goochie 11. Dr. Goochie Lv 1 49 pts. 11,181
  2. Avatar for Galaxie 12. Galaxie Lv 1 46 pts. 11,171
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 42 pts. 11,148
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 39 pts. 11,127
  5. Avatar for akaaka 15. akaaka Lv 1 36 pts. 11,126
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 33 pts. 11,106
  7. Avatar for Alistair69 17. Alistair69 Lv 1 31 pts. 11,060
  8. Avatar for dpmattingly 18. dpmattingly Lv 1 28 pts. 11,055
  9. Avatar for g_b 19. g_b Lv 1 26 pts. 11,035
  10. Avatar for zxspectrum 20. zxspectrum Lv 1 24 pts. 11,017

Comments