Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 4 months ago

Novice Overall Prediction

Summary


Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Go Science 100 pts. 11,335
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,310
  3. Avatar for VeFold 3. VeFold 44 pts. 11,278
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,227
  5. Avatar for Australia 5. Australia 16 pts. 11,127
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,005
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,966
  8. Avatar for Contenders 8. Contenders 3 pts. 10,927
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,806
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,728

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 22 pts. 11,005
  2. Avatar for TheGUmmer 22. TheGUmmer Lv 1 20 pts. 10,966
  3. Avatar for georg137 23. georg137 Lv 1 18 pts. 10,927
  4. Avatar for BootsMcGraw 24. BootsMcGraw Lv 1 17 pts. 10,890
  5. Avatar for ProfVince 25. ProfVince Lv 1 15 pts. 10,870
  6. Avatar for Elfi 26. Elfi Lv 1 14 pts. 10,869
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 12 pts. 10,865
  8. Avatar for gmn 28. gmn Lv 1 11 pts. 10,842
  9. Avatar for orily1337 29. orily1337 Lv 1 10 pts. 10,806
  10. Avatar for Apothecary1815 30. Apothecary1815 Lv 1 9 pts. 10,775

Comments