Icon representing a puzzle

2698: Revisiting Puzzle 63: Spinach Protein

Closed since 4 months ago

Novice Overall Prediction

Summary


Created
December 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Go Science 100 pts. 11,335
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,310
  3. Avatar for VeFold 3. VeFold 44 pts. 11,278
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,227
  5. Avatar for Australia 5. Australia 16 pts. 11,127
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,005
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 10,966
  8. Avatar for Contenders 8. Contenders 3 pts. 10,927
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,806
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,728

  1. Avatar for ZiiONIC 41. ZiiONIC Lv 1 3 pts. 10,330
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 2 pts. 10,275
  3. Avatar for Fasodankfds 43. Fasodankfds Lv 1 2 pts. 10,196
  4. Avatar for DodoBird 44. DodoBird Lv 1 2 pts. 10,150
  5. Avatar for Savas 45. Savas Lv 1 2 pts. 10,132
  6. Avatar for pfirth 46. pfirth Lv 1 2 pts. 10,127
  7. Avatar for Trajan464 47. Trajan464 Lv 1 1 pt. 10,110
  8. Avatar for hada 48. hada Lv 1 1 pt. 10,072
  9. Avatar for westchuck 49. westchuck Lv 1 1 pt. 10,046
  10. Avatar for LHOr 50. LHOr Lv 1 1 pt. 9,937

Comments