Placeholder image of a protein
Icon representing a puzzle

2702: Electron Density Reconstruction 149

Closed since 5 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 10, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2F7K. It's large, so the trim tool is recommended.

Sequence
SYYHHHHHHHEGVRTMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 71,270
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 67,472
  3. Avatar for CBE_ProEn_2025 13. CBE_ProEn_2025 1 pt. 67,149

  1. Avatar for ichwilldiesennamen 100 pts. 75,223
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 94 pts. 75,014
  3. Avatar for Dr. Goochie 3. Dr. Goochie Lv 1 87 pts. 75,001
  4. Avatar for Zhang Ruichong 4. Zhang Ruichong Lv 1 81 pts. 74,993
  5. Avatar for gmn 5. gmn Lv 1 75 pts. 74,864
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 70 pts. 74,792
  7. Avatar for spvincent 7. spvincent Lv 1 65 pts. 74,743
  8. Avatar for LociOiling 8. LociOiling Lv 1 60 pts. 74,728
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 56 pts. 74,681
  10. Avatar for Galaxie 10. Galaxie Lv 1 51 pts. 74,653

Comments