Placeholder image of a protein
Icon representing a puzzle

2702: Electron Density Reconstruction 149

Closed since 4 months ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
December 10, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2F7K. It's large, so the trim tool is recommended.

Sequence
SYYHHHHHHHEGVRTMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Top groups


  1. Avatar for Contenders 100 pts. 75,414
  2. Avatar for Go Science 2. Go Science 65 pts. 75,297
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 74,864
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 74,792
  5. Avatar for VeFold 5. VeFold 14 pts. 74,681
  6. Avatar for Australia 6. Australia 7 pts. 74,100
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 73,972
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 73,478
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 73,349
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 71,552

  1. Avatar for ichwilldiesennamen 100 pts. 75,223
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 94 pts. 75,014
  3. Avatar for Dr. Goochie 3. Dr. Goochie Lv 1 87 pts. 75,001
  4. Avatar for Zhang Ruichong 4. Zhang Ruichong Lv 1 81 pts. 74,993
  5. Avatar for gmn 5. gmn Lv 1 75 pts. 74,864
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 70 pts. 74,792
  7. Avatar for spvincent 7. spvincent Lv 1 65 pts. 74,743
  8. Avatar for LociOiling 8. LociOiling Lv 1 60 pts. 74,728
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 56 pts. 74,681
  10. Avatar for Galaxie 10. Galaxie Lv 1 51 pts. 74,653

Comments