Placeholder image of a protein
Icon representing a puzzle

2702: Electron Density Reconstruction 149

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 10, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2F7K. It's large, so the trim tool is recommended.

Sequence
SYYHHHHHHHEGVRTMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Top groups


  1. Avatar for Contenders 100 pts. 75,414
  2. Avatar for Go Science 2. Go Science 65 pts. 75,297
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 74,864
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 74,792
  5. Avatar for VeFold 5. VeFold 14 pts. 74,681
  6. Avatar for Australia 6. Australia 7 pts. 74,100
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 73,972
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 73,478
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 73,349
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 71,552

  1. Avatar for Th1sN@me!sN0tAPun 51. Th1sN@me!sN0tAPun Lv 1 1 pt. 68,832
  2. Avatar for carsonfb 52. carsonfb Lv 1 1 pt. 68,340
  3. Avatar for Mohoernchen 53. Mohoernchen Lv 1 1 pt. 68,329
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 68,080
  5. Avatar for rinze 56. rinze Lv 1 1 pt. 67,883
  6. Avatar for RWoodcock 57. RWoodcock Lv 1 1 pt. 67,817
  7. Avatar for JDewyer 58. JDewyer Lv 1 1 pt. 67,758
  8. Avatar for Swapper242 59. Swapper242 Lv 1 1 pt. 67,646
  9. Avatar for Sammy3c2b1a0 60. Sammy3c2b1a0 Lv 1 1 pt. 67,472

Comments