Placeholder image of a protein
Icon representing a puzzle

2702: Electron Density Reconstruction 149

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 10, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2F7K. It's large, so the trim tool is recommended.

Sequence
SYYHHHHHHHEGVRTMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Top groups


  1. Avatar for Contenders 100 pts. 75,414
  2. Avatar for Go Science 2. Go Science 65 pts. 75,297
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 74,864
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 74,792
  5. Avatar for VeFold 5. VeFold 14 pts. 74,681
  6. Avatar for Australia 6. Australia 7 pts. 74,100
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 73,972
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 73,478
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 73,349
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 71,552

  1. Avatar for rovergaard 61. rovergaard Lv 1 1 pt. 67,149
  2. Avatar for uni9999 62. uni9999 Lv 1 1 pt. 66,990
  3. Avatar for Fasodankfds 63. Fasodankfds Lv 1 1 pt. 66,203
  4. Avatar for p.naka 64. p.naka Lv 1 1 pt. 63,926
  5. Avatar for cameorn 65. cameorn Lv 1 1 pt. 60,277
  6. Avatar for Wildice1100 66. Wildice1100 Lv 1 1 pt. 58,639
  7. Avatar for HNOF 67. HNOF Lv 1 1 pt. 11,481
  8. Avatar for sato 68. sato Lv 1 1 pt. 10,223
  9. Avatar for salbei 69. salbei Lv 1 1 pt. 10,016
  10. Avatar for ProfVince 70. ProfVince Lv 1 1 pt. 10,016

Comments