Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 11,333
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 11,188
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,861
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,846
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 10,807
  6. Avatar for Team China 16. Team China 1 pt. 10,785
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 11,822
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 11,804
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 11,778
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 83 pts. 11,751
  5. Avatar for Galaxie 5. Galaxie Lv 1 78 pts. 11,747
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 73 pts. 11,742
  7. Avatar for Serca 7. Serca Lv 1 68 pts. 11,723
  8. Avatar for BootsMcGraw 8. BootsMcGraw Lv 1 63 pts. 11,685
  9. Avatar for akaaka 9. akaaka Lv 1 59 pts. 11,684
  10. Avatar for nicobul 10. nicobul Lv 1 55 pts. 11,683

Comments