Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 5 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,826
  2. Avatar for Go Science 2. Go Science 71 pts. 11,778
  3. Avatar for VeFold 3. VeFold 49 pts. 11,742
  4. Avatar for Contenders 4. Contenders 33 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,683
  6. Avatar for Australia 6. Australia 14 pts. 11,639
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,625
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,543
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 11,471
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,460

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 11,822
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 11,804
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 11,778
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 83 pts. 11,751
  5. Avatar for Galaxie 5. Galaxie Lv 1 78 pts. 11,747
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 73 pts. 11,742
  7. Avatar for Serca 7. Serca Lv 1 68 pts. 11,723
  8. Avatar for BootsMcGraw 8. BootsMcGraw Lv 1 63 pts. 11,685
  9. Avatar for akaaka 9. akaaka Lv 1 59 pts. 11,684
  10. Avatar for nicobul 10. nicobul Lv 1 55 pts. 11,683

Comments