Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 4 months ago

Novice Overall Prediction

Summary


Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,826
  2. Avatar for Go Science 2. Go Science 71 pts. 11,778
  3. Avatar for VeFold 3. VeFold 49 pts. 11,742
  4. Avatar for Contenders 4. Contenders 33 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,683
  6. Avatar for Australia 6. Australia 14 pts. 11,639
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,625
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,543
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 11,471
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,460

  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 11,192
  2. Avatar for rovergaard 52. rovergaard Lv 1 1 pt. 11,188
  3. Avatar for ZiiONIC 53. ZiiONIC Lv 1 1 pt. 11,111
  4. Avatar for Wildice1100 54. Wildice1100 Lv 1 1 pt. 11,069
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 1 pt. 11,045
  6. Avatar for Flagg65a 56. Flagg65a Lv 1 1 pt. 10,993
  7. Avatar for p.naka 57. p.naka Lv 1 1 pt. 10,952
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 10,944
  9. Avatar for Bletchley Park 59. Bletchley Park Lv 1 1 pt. 10,932
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 10,909

Comments