Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 4 months ago

Novice Overall Prediction

Summary


Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,826
  2. Avatar for Go Science 2. Go Science 71 pts. 11,778
  3. Avatar for VeFold 3. VeFold 49 pts. 11,742
  4. Avatar for Contenders 4. Contenders 33 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,683
  6. Avatar for Australia 6. Australia 14 pts. 11,639
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,625
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,543
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 11,471
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,460

  1. Avatar for DScott 61. DScott Lv 1 1 pt. 10,898
  2. Avatar for RWoodcock 62. RWoodcock Lv 1 1 pt. 10,863
  3. Avatar for Savas 63. Savas Lv 1 1 pt. 10,861
  4. Avatar for Shadowmaster_ 64. Shadowmaster_ Lv 1 1 pt. 10,847
  5. Avatar for fikret 65. fikret Lv 1 1 pt. 10,846
  6. Avatar for efull 66. efull Lv 1 1 pt. 10,842
  7. Avatar for s8b07ting@163.com 67. s8b07ting@163.com Lv 1 1 pt. 10,817
  8. Avatar for uni9999 68. uni9999 Lv 1 1 pt. 10,814
  9. Avatar for Sammy3c2b1a0 69. Sammy3c2b1a0 Lv 1 1 pt. 10,807
  10. Avatar for yuta329 70. yuta329 Lv 1 1 pt. 10,805

Comments