Placeholder image of a protein
Icon representing a puzzle

2708: Electron Density Reconstruction 151

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 55,083
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 54,528
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 52,544
  4. Avatar for CBE_ProEn_2025 14. CBE_ProEn_2025 1 pt. 46,520

  1. Avatar for christioanchauvin 100 pts. 56,877
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 94 pts. 56,850
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 56,800
  4. Avatar for Galaxie 4. Galaxie Lv 1 81 pts. 56,748
  5. Avatar for Aarav_Awasthi 5. Aarav_Awasthi Lv 1 75 pts. 56,725
  6. Avatar for Dr. Goochie 6. Dr. Goochie Lv 1 70 pts. 56,660
  7. Avatar for bravosk8erboy 7. bravosk8erboy Lv 1 65 pts. 56,653
  8. Avatar for gmn 8. gmn Lv 1 60 pts. 56,643
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 56 pts. 56,638
  10. Avatar for Xendrais 10. Xendrais Lv 1 51 pts. 56,604

Comments