2708: Electron Density Reconstruction 151

Closed since 2 months ago

Summary

• Created: December 23, 2025
• Expires: January 08, 2026 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

• Sequence: SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups

• 1. L'Alliance Francophone 100 pts. 56,877
• 2. Contenders 68 pts. 56,850
• 3. Anthropic Dreams 44 pts. 56,811
• 4. Go Science 27 pts. 56,740
• 5. VeFold 16 pts. 56,604
• 6. Australia 9 pts. 56,440
• 7. FamilyBarmettler 5 pts. 56,365
• 8. Void Crushers 3 pts. 56,206
• 9. Marvin's bunch 1 pt. 56,145
• 10. SETI.Germany 1 pt. 55,437

Top soloists

• 1. christioanchauvin 100 pts. 56,877
• 2. Bletchley Park 94 pts. 56,850
• 3. LociOiling 87 pts. 56,800
• 4. Galaxie 81 pts. 56,748
• 5. Aarav_Awasthi 75 pts. 56,725
• 6. Dr. Goochie 70 pts. 56,660
• 7. bravosk8erboy 65 pts. 56,653
• 8. gmn 60 pts. 56,643
• 9. Bruno Kestemont 56 pts. 56,638
• 10. Xendrais 51 pts. 56,604