Placeholder image of a protein
Icon representing a puzzle

2708: Electron Density Reconstruction 151

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 55,083
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 54,528
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 52,544
  4. Avatar for CBE_ProEn_2025 14. CBE_ProEn_2025 1 pt. 46,520
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 47 pts. 56,546
  2. Avatar for grogar7 12. grogar7 Lv 1 44 pts. 56,546
  3. Avatar for dpmattingly 13. dpmattingly Lv 1 40 pts. 56,527
  4. Avatar for ZeroLeak7 14. ZeroLeak7 Lv 1 37 pts. 56,456
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 34 pts. 56,440
  6. Avatar for akaaka 16. akaaka Lv 1 31 pts. 56,431
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 28 pts. 56,365
  8. Avatar for g_b 18. g_b Lv 1 26 pts. 56,296
  9. Avatar for westchuck 19. westchuck Lv 1 24 pts. 56,269
  10. Avatar for Elfi 20. Elfi Lv 1 22 pts. 56,247

Comments