Placeholder image of a protein
Icon representing a puzzle

2708: Electron Density Reconstruction 151

Closed since 2 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 55,083
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 54,528
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 52,544
  4. Avatar for CBE_ProEn_2025 14. CBE_ProEn_2025 1 pt. 46,520
  1. Avatar for toshiue 31. toshiue Lv 1 7 pts. 55,976
  2. Avatar for georg137 32. georg137 Lv 1 6 pts. 55,915
  3. Avatar for nicobul 33. nicobul Lv 1 6 pts. 55,854
  4. Avatar for zxspectrum 34. zxspectrum Lv 1 5 pts. 55,621
  5. Avatar for manu8170 35. manu8170 Lv 1 4 pts. 55,582
  6. Avatar for aendgraend 36. aendgraend Lv 1 4 pts. 55,437
  7. Avatar for drjr 37. drjr Lv 1 3 pts. 55,280
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 3 pts. 55,280
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 3 pts. 55,229
  10. Avatar for ichwilldiesennamen 40. ichwilldiesennamen Lv 1 2 pts. 55,207

Comments