Placeholder image of a protein
Icon representing a puzzle

2708: Electron Density Reconstruction 151

Closed since 2 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 56,877
  2. Avatar for Contenders 2. Contenders 68 pts. 56,850
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 56,811
  4. Avatar for Go Science 4. Go Science 27 pts. 56,740
  5. Avatar for VeFold 5. VeFold 16 pts. 56,604
  6. Avatar for Australia 6. Australia 9 pts. 56,440
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 56,365
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 56,206
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 56,145
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 55,437

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 56,811
  2. Avatar for LociOiling 2. LociOiling Lv 1 33 pts. 56,799
  3. Avatar for toshiue 3. toshiue Lv 1 8 pts. 56,740
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 2 pts. 56,731
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 1 pt. 56,613
  6. Avatar for silent gene 6. silent gene Lv 1 1 pt. 56,076

Comments