Placeholder image of a protein
Icon representing a puzzle

2708: Electron Density Reconstruction 151

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 56,877
  2. Avatar for Contenders 2. Contenders 68 pts. 56,850
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 56,811
  4. Avatar for Go Science 4. Go Science 27 pts. 56,740
  5. Avatar for VeFold 5. VeFold 16 pts. 56,604
  6. Avatar for Australia 6. Australia 9 pts. 56,440
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 56,365
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 56,206
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 56,145
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 55,437

  1. Avatar for BotError404 51. BotError404 Lv 1 1 pt. 54,574
  2. Avatar for ShadowTactics 52. ShadowTactics Lv 1 1 pt. 54,528
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 54,359
  4. Avatar for zbp 54. zbp Lv 1 1 pt. 54,352
  5. Avatar for ProfVince 55. ProfVince Lv 1 1 pt. 54,299
  6. Avatar for pfirth 56. pfirth Lv 1 1 pt. 54,105
  7. Avatar for Altercomp 57. Altercomp Lv 1 1 pt. 53,668
  8. Avatar for ZiiONIC 58. ZiiONIC Lv 1 1 pt. 53,343
  9. Avatar for Mohoernchen 59. Mohoernchen Lv 1 1 pt. 53,306
  10. Avatar for p.naka 60. p.naka Lv 1 1 pt. 53,268

Comments