Placeholder image of a protein
Icon representing a puzzle

2708: Electron Density Reconstruction 151

Closed since 5 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

Sequence
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 56,877
  2. Avatar for Contenders 2. Contenders 68 pts. 56,850
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 56,811
  4. Avatar for Go Science 4. Go Science 27 pts. 56,740
  5. Avatar for VeFold 5. VeFold 16 pts. 56,604
  6. Avatar for Australia 6. Australia 9 pts. 56,440
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 56,365
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 56,206
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 56,145
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 55,437

  1. Avatar for jz 61. jz Lv 1 1 pt. 53,130
  2. Avatar for RWoodcock 62. RWoodcock Lv 1 1 pt. 53,114
  3. Avatar for DScott 63. DScott Lv 1 1 pt. 52,823
  4. Avatar for efull 64. efull Lv 1 1 pt. 52,810
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 52,559
  6. Avatar for Sammy3c2b1a0 66. Sammy3c2b1a0 Lv 1 1 pt. 52,544
  7. Avatar for ditto 67. ditto Lv 1 1 pt. 52,370
  8. Avatar for Hellcat6 68. Hellcat6 Lv 1 1 pt. 52,265
  9. Avatar for rovergaard 69. rovergaard Lv 1 1 pt. 46,520
  10. Avatar for LHOr 70. LHOr Lv 1 1 pt. 38,390

Comments