2708: Electron Density Reconstruction 151

Closed since 2 months ago

Summary

• Created: December 23, 2025
• Expires: January 08, 2026 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains and some DNA, and comes from PDB entry 2H8R. It's a bit large, so the trim tool is recommended. Happy new year everyone!

• Sequence: SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR GCTGGTGAATTATTAACCAA CTTGGTTAATAATTCACCAG

Top groups

• 1. L'Alliance Francophone 100 pts. 56,877
• 2. Contenders 68 pts. 56,850
• 3. Anthropic Dreams 44 pts. 56,811
• 4. Go Science 27 pts. 56,740
• 5. VeFold 16 pts. 56,604
• 6. Australia 9 pts. 56,440
• 7. FamilyBarmettler 5 pts. 56,365
• 8. Void Crushers 3 pts. 56,206
• 9. Marvin's bunch 1 pt. 56,145
• 10. SETI.Germany 1 pt. 55,437

Top soloists

• 21. majyunyan 20 pts. 56,231
• 22. spvincent 18 pts. 56,227
• 23. BarrySampson 16 pts. 56,210
• 24. TheGUmmer 15 pts. 56,206
• 25. SemperRabbit 13 pts. 56,196
• 26. silent gene 12 pts. 56,155
• 27. jausmh 11 pts. 56,145
• 28. NinjaGreg 10 pts. 56,074
• 29. BootsMcGraw 9 pts. 56,059
• 30. Wanderer09 8 pts. 56,057