Icon representing a puzzle

2704: Revisiting Puzzle 66: Cytochrome

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
December 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Go Science 100 pts. 10,296
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,254
  3. Avatar for VeFold 3. VeFold 41 pts. 10,207
  4. Avatar for Contenders 4. Contenders 24 pts. 10,205
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,201
  6. Avatar for Australia 6. Australia 7 pts. 10,184
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,170
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,146
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,138
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,036

  1. Avatar for akaaka
    1. akaaka Lv 1
    100 pts. 10,347
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 10,296
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 87 pts. 10,270
  4. Avatar for LociOiling 4. LociOiling Lv 1 81 pts. 10,254
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 75 pts. 10,248
  6. Avatar for grogar7 6. grogar7 Lv 1 70 pts. 10,243
  7. Avatar for toshiue 7. toshiue Lv 1 64 pts. 10,216
  8. Avatar for Elfi 8. Elfi Lv 1 60 pts. 10,207
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 55 pts. 10,205
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 51 pts. 10,201

Comments