Icon representing a puzzle

2704: Revisiting Puzzle 66: Cytochrome

Closed since 4 months ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
December 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 9,806
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,626
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,559

  1. Avatar for akaaka
    1. akaaka Lv 1
    100 pts. 10,347
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 10,296
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 87 pts. 10,270
  4. Avatar for LociOiling 4. LociOiling Lv 1 81 pts. 10,254
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 75 pts. 10,248
  6. Avatar for grogar7 6. grogar7 Lv 1 70 pts. 10,243
  7. Avatar for toshiue 7. toshiue Lv 1 64 pts. 10,216
  8. Avatar for Elfi 8. Elfi Lv 1 60 pts. 10,207
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 55 pts. 10,205
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 51 pts. 10,201

Comments