Icon representing a puzzle

2704: Revisiting Puzzle 66: Cytochrome

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
December 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 9,806
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,626
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,559

  1. Avatar for TheGUmmer 21. TheGUmmer Lv 1 19 pts. 10,170
  2. Avatar for Aarav_Awasthi 22. Aarav_Awasthi Lv 1 17 pts. 10,166
  3. Avatar for Dr.Sillem 23. Dr.Sillem Lv 1 16 pts. 10,158
  4. Avatar for g_b 24. g_b Lv 1 14 pts. 10,154
  5. Avatar for dpmattingly 25. dpmattingly Lv 1 13 pts. 10,153
  6. Avatar for Joanna_H 26. Joanna_H Lv 1 11 pts. 10,146
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 10 pts. 10,138
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 9 pts. 10,137
  9. Avatar for alcor29 29. alcor29 Lv 1 8 pts. 10,135
  10. Avatar for Dr. Goochie 30. Dr. Goochie Lv 1 7 pts. 10,133

Comments