Icon representing a puzzle

2704: Revisiting Puzzle 66: Cytochrome

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 9,806
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,626
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,559
  1. Avatar for hada 41. hada Lv 1 2 pts. 10,038
  2. Avatar for heather-1 42. heather-1 Lv 1 2 pts. 10,038
  3. Avatar for aendgraend 43. aendgraend Lv 1 2 pts. 10,036
  4. Avatar for pfirth 44. pfirth Lv 1 1 pt. 10,025
  5. Avatar for zbp 45. zbp Lv 1 1 pt. 9,957
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 1 pt. 9,931
  7. Avatar for Crabbex 47. Crabbex Lv 1 1 pt. 9,927
  8. Avatar for Larini 48. Larini Lv 1 1 pt. 9,920
  9. Avatar for ZiiONIC 49. ZiiONIC Lv 1 1 pt. 9,898
  10. Avatar for rovergaard 50. rovergaard Lv 1 1 pt. 9,806

Comments