Icon representing a puzzle

2704: Revisiting Puzzle 66: Cytochrome

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 9,806
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,626
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,559
  1. Avatar for p.naka 61. p.naka Lv 1 1 pt. 9,535
  2. Avatar for zimoh45 62. zimoh45 Lv 1 1 pt. 9,453
  3. Avatar for Sammy3c2b1a0 63. Sammy3c2b1a0 Lv 1 1 pt. 9,436
  4. Avatar for Matrena 64. Matrena Lv 1 1 pt. 9,412
  5. Avatar for RWoodcock 65. RWoodcock Lv 1 1 pt. 9,393
  6. Avatar for NickMihal 66. NickMihal Lv 1 1 pt. 9,354
  7. Avatar for DipsyDoodle2016 67. DipsyDoodle2016 Lv 1 1 pt. 9,276
  8. Avatar for Jenot96 68. Jenot96 Lv 1 1 pt. 9,251
  9. Avatar for lordveznan 69. lordveznan Lv 1 1 pt. 9,059
  10. Avatar for gbuaistsar 70. gbuaistsar Lv 1 1 pt. 8,204

Comments