Icon representing a puzzle

2704: Revisiting Puzzle 66: Cytochrome

Closed since 4 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Go Science 100 pts. 10,296
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,254
  3. Avatar for VeFold 3. VeFold 41 pts. 10,207
  4. Avatar for Contenders 4. Contenders 24 pts. 10,205
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,201
  6. Avatar for Australia 6. Australia 7 pts. 10,184
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,170
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,146
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,138
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,036

  1. Avatar for Aubade01 11. Aubade01 Lv 1 47 pts. 10,195
  2. Avatar for westchuck 12. westchuck Lv 1 43 pts. 10,194
  3. Avatar for Galaxie 13. Galaxie Lv 1 40 pts. 10,192
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 36 pts. 10,188
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 33 pts. 10,184
  6. Avatar for Zhang Ruichong 16. Zhang Ruichong Lv 1 30 pts. 10,180
  7. Avatar for majyunyan 17. majyunyan Lv 1 28 pts. 10,178
  8. Avatar for georg137 18. georg137 Lv 1 25 pts. 10,178
  9. Avatar for SemperRabbit 19. SemperRabbit Lv 1 23 pts. 10,177
  10. Avatar for nicobul 20. nicobul Lv 1 21 pts. 10,174

Comments