Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 2 months ago

Novice Overall Prediction

Summary

Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,525
  2. Avatar for Go Science 2. Go Science 68 pts. 10,481
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,435
  4. Avatar for VeFold 4. VeFold 27 pts. 10,428
  5. Avatar for Australia 5. Australia 16 pts. 10,419
  6. Avatar for Contenders 6. Contenders 9 pts. 10,400
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,366
  8. Avatar for SETI.Germany 8. SETI.Germany 3 pts. 10,142
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,136
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,074
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,525
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 10,481
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 10,450
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 82 pts. 10,444
  5. Avatar for nicobul 5. nicobul Lv 1 77 pts. 10,435
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 72 pts. 10,428
  7. Avatar for grogar7 7. grogar7 Lv 1 67 pts. 10,421
  8. Avatar for AlkiP0Ps 8. AlkiP0Ps Lv 1 62 pts. 10,419
  9. Avatar for akaaka 9. akaaka Lv 1 58 pts. 10,419
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 54 pts. 10,409

Comments