Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 5 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,791
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 9,470
  3. Avatar for Marvin's bunch 13. Marvin's bunch 1 pt. 9,443
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,259

  1. Avatar for Galaxie 11. Galaxie Lv 1 50 pts. 10,407
  2. Avatar for gmn 12. gmn Lv 1 46 pts. 10,407
  3. Avatar for georg137 13. georg137 Lv 1 43 pts. 10,400
  4. Avatar for g_b 14. g_b Lv 1 40 pts. 10,397
  5. Avatar for Aarav_Awasthi 15. Aarav_Awasthi Lv 1 37 pts. 10,389
  6. Avatar for dpmattingly 16. dpmattingly Lv 1 34 pts. 10,388
  7. Avatar for Dr. Goochie 17. Dr. Goochie Lv 1 31 pts. 10,377
  8. Avatar for Elfi 18. Elfi Lv 1 29 pts. 10,369
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 26 pts. 10,368
  10. Avatar for Aubade01 20. Aubade01 Lv 1 24 pts. 10,367

Comments