Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 2 months ago

Novice Overall Prediction

Summary

Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,791
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 9,470
  3. Avatar for Marvin's bunch 13. Marvin's bunch 1 pt. 9,443
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,259
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 22 pts. 10,366
  2. Avatar for westchuck 22. westchuck Lv 1 20 pts. 10,355
  3. Avatar for SemperRabbit 23. SemperRabbit Lv 1 19 pts. 10,347
  4. Avatar for BootsMcGraw 24. BootsMcGraw Lv 1 17 pts. 10,337
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 15 pts. 10,330
  6. Avatar for BarrySampson 26. BarrySampson Lv 1 14 pts. 10,305
  7. Avatar for majyunyan 27. majyunyan Lv 1 13 pts. 10,267
  8. Avatar for Wanderer09 28. Wanderer09 Lv 1 12 pts. 10,265
  9. Avatar for silent gene 29. silent gene Lv 1 11 pts. 10,256
  10. Avatar for Tehnologik1 30. Tehnologik1 Lv 1 10 pts. 10,253

Comments