Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 2 months ago

Novice Overall Prediction

Summary

Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,791
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 9,470
  3. Avatar for Marvin's bunch 13. Marvin's bunch 1 pt. 9,443
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,259
  1. Avatar for ichwilldiesennamen 31. ichwilldiesennamen Lv 1 9 pts. 10,243
  2. Avatar for zxspectrum 32. zxspectrum Lv 1 8 pts. 10,223
  3. Avatar for drjr 33. drjr Lv 1 7 pts. 10,222
  4. Avatar for Xendrais 34. Xendrais Lv 1 6 pts. 10,197
  5. Avatar for Dr.Sillem 35. Dr.Sillem Lv 1 6 pts. 10,189
  6. Avatar for aendgraend 36. aendgraend Lv 1 5 pts. 10,142
  7. Avatar for TheGUmmer 37. TheGUmmer Lv 1 5 pts. 10,136
  8. Avatar for toshiue 38. toshiue Lv 1 4 pts. 10,125
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 4 pts. 10,116
  10. Avatar for Larini 40. Larini Lv 1 3 pts. 10,094

Comments