Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 2 months ago

Novice Overall Prediction

Summary

Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,791
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 9,470
  3. Avatar for Marvin's bunch 13. Marvin's bunch 1 pt. 9,443
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,259
  1. Avatar for ZiiONIC 41. ZiiONIC Lv 1 3 pts. 10,085
  2. Avatar for Joanna_H 42. Joanna_H Lv 1 3 pts. 10,074
  3. Avatar for Alistair69 43. Alistair69 Lv 1 2 pts. 10,073
  4. Avatar for heather-1 44. heather-1 Lv 1 2 pts. 10,071
  5. Avatar for Floddi 45. Floddi Lv 1 2 pts. 10,057
  6. Avatar for carxo 46. carxo Lv 1 2 pts. 10,046
  7. Avatar for jamestpierce 47. jamestpierce Lv 1 1 pt. 10,034
  8. Avatar for pfirth 48. pfirth Lv 1 1 pt. 10,005
  9. Avatar for Hellcat6 49. Hellcat6 Lv 1 1 pt. 9,995
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 1 pt. 9,977

Comments