Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 2 months ago

Novice Overall Prediction

Summary

Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,791
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 9,470
  3. Avatar for Marvin's bunch 13. Marvin's bunch 1 pt. 9,443
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,259
  1. Avatar for zbp 61. zbp Lv 1 1 pt. 9,619
  2. Avatar for matt61ger 62. matt61ger Lv 1 1 pt. 9,585
  3. Avatar for DScott 63. DScott Lv 1 1 pt. 9,528
  4. Avatar for rovergaard 64. rovergaard Lv 1 1 pt. 9,470
  5. Avatar for jausmh 65. jausmh Lv 1 1 pt. 9,443
  6. Avatar for arotomic 66. arotomic Lv 1 1 pt. 9,343
  7. Avatar for RWoodcock 67. RWoodcock Lv 1 1 pt. 9,319
  8. Avatar for efull 68. efull Lv 1 1 pt. 9,305
  9. Avatar for Sammy3c2b1a0 69. Sammy3c2b1a0 Lv 1 1 pt. 9,259
  10. Avatar for ditto 70. ditto Lv 1 1 pt. 9,214

Comments