Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 2 months ago

Novice Overall Prediction

Summary

Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,791
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 9,470
  3. Avatar for Marvin's bunch 13. Marvin's bunch 1 pt. 9,443
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,259
  1. Avatar for froschi2 71. froschi2 Lv 1 1 pt. 9,171
  2. Avatar for Connor_Lawrence 72. Connor_Lawrence Lv 1 1 pt. 9,167
  3. Avatar for Chri03jj 73. Chri03jj Lv 1 1 pt. 9,050
  4. Avatar for AlphaFold2 74. AlphaFold2 Lv 1 1 pt. 8,949
  5. Avatar for JellyfishOliPlays 75. JellyfishOliPlays Lv 1 1 pt. 8,238
  6. Avatar for Jesusmed 76. Jesusmed Lv 1 1 pt. 5,631
  7. Avatar for apetrides 77. apetrides Lv 1 1 pt. 3,038

Comments