Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 4 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,525
  2. Avatar for Go Science 2. Go Science 68 pts. 10,481
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,435
  4. Avatar for VeFold 4. VeFold 27 pts. 10,428
  5. Avatar for Australia 5. Australia 16 pts. 10,419
  6. Avatar for Contenders 6. Contenders 9 pts. 10,400
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,366
  8. Avatar for SETI.Germany 8. SETI.Germany 3 pts. 10,142
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,136
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,074

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,523
  2. Avatar for Galaxie 2. Galaxie Lv 1 33 pts. 10,521
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 8 pts. 10,478
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 2 pts. 10,477
  5. Avatar for toshiue 5. toshiue Lv 1 1 pt. 10,475
  6. Avatar for silent gene 6. silent gene Lv 1 1 pt. 10,474

Comments