Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,525
  2. Avatar for Go Science 2. Go Science 68 pts. 10,481
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,435
  4. Avatar for VeFold 4. VeFold 27 pts. 10,428
  5. Avatar for Australia 5. Australia 16 pts. 10,419
  6. Avatar for Contenders 6. Contenders 9 pts. 10,400
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,366
  8. Avatar for SETI.Germany 8. SETI.Germany 3 pts. 10,142
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,136
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,074

  1. Avatar for ichwilldiesennamen 31. ichwilldiesennamen Lv 1 9 pts. 10,243
  2. Avatar for zxspectrum 32. zxspectrum Lv 1 8 pts. 10,223
  3. Avatar for drjr 33. drjr Lv 1 7 pts. 10,222
  4. Avatar for Xendrais 34. Xendrais Lv 1 6 pts. 10,197
  5. Avatar for Dr.Sillem 35. Dr.Sillem Lv 1 6 pts. 10,189
  6. Avatar for aendgraend 36. aendgraend Lv 1 5 pts. 10,142
  7. Avatar for TheGUmmer 37. TheGUmmer Lv 1 5 pts. 10,136
  8. Avatar for toshiue 38. toshiue Lv 1 4 pts. 10,125
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 4 pts. 10,116
  10. Avatar for Larini 40. Larini Lv 1 3 pts. 10,094

Comments